Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria icaB protein

This Bacteria icaB protein spans the amino acid sequence from region 29-290aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Biofilm polysaccharide intercellular adhesin deacetylase Short name, Biofilm PIA deacetylase Intercellular adhesion protein B

UniProt

Q7A349

Expression Region

29-290aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain N315)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NADDDSPKKLKYKENSALALNYHRVRKANFLNNFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINFDDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFETHTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPVIKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brd3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4636406 1.0 µg DNA

Brd3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Calmodulin, CT (CaM, CALM, CAM1, CAM) (MaxLight 550) discontinued
C1035-05A1-ML550 100 µL

Calmodulin, CT (CaM, CALM, CAM1, CAM) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal PHD4/HIF Prolyl Hydroxylase 4 Antibody [DyLight 405]
NB100-295V 0.1 mL

Rabbit Polyclonal PHD4/HIF Prolyl Hydroxylase 4 Antibody [DyLight 405]

Sign In for Pricing
View Details
BNP Rabbit Polyclonal Antibody (BF488)
orb2415388 100 µL

BNP Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
Recombinant Viral CKBP
8254-CK-025 25 µg

Recombinant Viral CKBP

Sign In for Pricing
View Details
ABHD12 Recombinant Protein (Rat)
RP188645 100 µg

ABHD12 Recombinant Protein (Rat)

Sign In for Pricing
View Details