Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria icaB protein

This Bacteria icaB protein spans the amino acid sequence from region 29-290aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Biofilm polysaccharide intercellular adhesin deacetylase Short name, Biofilm PIA deacetylase Intercellular adhesion protein B

UniProt

Q7A349

Expression Region

29-290aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain N315)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NADDDSPKKLKYKENSALALNYHRVRKANFLNNFIYFFSSSKEIKNYSVSQSQFESQIKWLKSHDAKFLTLKEFLYYKKKGKFPKRSVWINFDDMDETIYENAYPILKKYKIPATGFIITGHVGEENFHNLDMISKKELKEMYKTGLWEFETHTHDLHNLSKNNKSKLMKASEATIIKDLNKSEKYLTKNFKKSQKTIAYPYGLMNDDKLPVIKKAGLKYGFSLEEKAVTPNSNDYYIPRILISDDAFEHLIKRWDGFHEKD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABI1 Protein Lysate (Mouse) with C-HA Tag
11102035 100 µg

ABI1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
1,8-Dinitropyrene (90%)
TRC-D480270-0.5MG 0.5 mg

1,8-Dinitropyrene (90%)

Sign In for Pricing
View Details
Recombinant Brucella Abortus rpsO Protein (strain 2308) (aa 1-89)
VAng-Lsx4871-500gEcoli 500 µg (E. coli)

Recombinant Brucella Abortus rpsO Protein (strain 2308) (aa 1-89)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) NUOK Polyclonal Antibody
MBS7189473 Inquire

Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) NUOK Polyclonal Antibody

Sign In for Pricing
View Details
EMP3 Rabbit pAb
A11580 100 µL

EMP3 Rabbit pAb

Sign In for Pricing
View Details
CCDC127 Polyclonal Antibody, Biotin Conjugated
bs-8113R-Biotin 100 µL

CCDC127 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details