Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse C1qa protein

This Mouse C1qa protein spans the amino acid sequence from region 23-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1qaComplement C1q subcomponent subunit A

UniProt

P98086

Expression Region

23-245aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ST8SIA1 Antibody (N-Term)
orb1925506-01 50 µL

ST8SIA1 Antibody (N-Term)

Sign In for Pricing
View Details
ST8SIA1 Antibody (N-Term)
orb1925506-02 100 µL

ST8SIA1 Antibody (N-Term)

Sign In for Pricing
View Details
Anti-Human PMF1 Antibody Fluoro488 Conjugated
DZ41628-Fluoro488 200 µL/Vial

Anti-Human PMF1 Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
Boc-Arg (Boc) ₂-OH
4011878.0005 5 g

Boc-Arg (Boc) ₂-OH

Sign In for Pricing
View Details
CDK18 discontinued
530359-01 20 µL

CDK18 discontinued

Sign In for Pricing
View Details
CDK18 discontinued
530359-02 100 µL

CDK18 discontinued

Sign In for Pricing
View Details