Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse C1qa protein

This Mouse C1qa protein spans the amino acid sequence from region 23-245aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1qaComplement C1q subcomponent subunit A

UniProt

P98086

Expression Region

23-245aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HADH Antibody, Rabbit Polyclonal
MBS8119212-01 0.1 mL

Anti-HADH Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-HADH Antibody, Rabbit Polyclonal
MBS8119212-02 5x 0.1 mL

Anti-HADH Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-CD96/TACTILE (Rabbit, Monoclonal)
A107662 100 µL

Anti-CD96/TACTILE (Rabbit, Monoclonal)

Sign In for Pricing
View Details
Olfr1043 Protein Vector (Mouse) (pPM-C-His)
PV208025 500 ng

Olfr1043 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Phospho-HDAC3 (S424) Antibody
MBS7121528-01 0.05 mg

Phospho-HDAC3 (S424) Antibody

Sign In for Pricing
View Details
Phospho-HDAC3 (S424) Antibody
MBS7121528-02 0.1 mg

Phospho-HDAC3 (S424) Antibody

Sign In for Pricing
View Details