Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant nifH protein

This Plant nifH protein spans the amino acid sequence from region 1-47aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nitrogenase Fe protein Nitrogenase component II Nitrogenase reductase

UniProt

P20623

Expression Region

1-47aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rhizobium leguminosarum

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Fhl1 ELISA Kit
ELI-48465r 96 Tests

Rat Fhl1 ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein C17orf99 (C17orf99) ELISA Kit
MBS2803730-01 48 Tests

Human Uncharacterized protein C17orf99 (C17orf99) ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein C17orf99 (C17orf99) ELISA Kit
MBS2803730-02 96 Tests

Human Uncharacterized protein C17orf99 (C17orf99) ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein C17orf99 (C17orf99) ELISA Kit
MBS2803730-03 5x 96 Tests

Human Uncharacterized protein C17orf99 (C17orf99) ELISA Kit

Sign In for Pricing
View Details
Human Uncharacterized protein C17orf99 (C17orf99) ELISA Kit
MBS2803730-04 10x 96 Tests

Human Uncharacterized protein C17orf99 (C17orf99) ELISA Kit

Sign In for Pricing
View Details
Mouse Pdk2 Antibody - N-terminal region
OAAB10373-400UL 400 µL

Mouse Pdk2 Antibody - N-terminal region

Sign In for Pricing
View Details