Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant nifH protein

This Plant nifH protein spans the amino acid sequence from region 1-47aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nitrogenase Fe protein Nitrogenase component II Nitrogenase reductase

UniProt

P20623

Expression Region

1-47aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rhizobium leguminosarum

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OOCA01099-25T - Human MMP14 Primer Pair
OOCA01099-25T 25 Tests

OOCA01099-25T - Human MMP14 Primer Pair

Sign In for Pricing
View Details
Mouse Angiostatin (ANG) ELISA Kit
RDR-ANG-Mu-48Tests 48 Tests

Mouse Angiostatin (ANG) ELISA Kit

Sign In for Pricing
View Details
RFX3 CRISPRa sgRNA lentivector (set of three targets)(Human)
38881121 3x 1.0µg DNA

RFX3 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Anti-IFN-γ mAb (PAN), biotin
3115-6-125 125 µg

Anti-IFN-γ mAb (PAN), biotin

Sign In for Pricing
View Details
Cow C-Reactive Protein (CRP) ELISA Kit, 96 tests, Quantitative
1055 1 Kit

Cow C-Reactive Protein (CRP) ELISA Kit, 96 tests, Quantitative

Sign In for Pricing
View Details
Synaptophysin Rabbit mAb
AB101859 100 µL

Synaptophysin Rabbit mAb

Sign In for Pricing
View Details