Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus NS1 protein

This Virus NS1 protein spans the amino acid sequence from region 277-545aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Non-structural protein NS1

UniProt

P18547

Expression Region

277-545aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Porcine parvovirus (strain NADL-2) (PPV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TKKEVSIKCTIRDLVNKRCTSIEDWMMTDPDSYIEMMAQTGGENLIKNTLEITTLTLARTKTAYDLILEKAKPSMLPTFNISNTRTCKIFSMHNWNYIKCCHAITCVLNRQGGKRNTILFHGPASTGKSIIAQHIANLVGNVGCYNAANVNFPFNDCTNKNLIWIEEAGNFSNQVNQFKAICSGQTIRIDQKGKGSKQIEPTPVIMTTNEDITKVRIGCEERPEHTQPIRDRMLNINLTRKLPGDFGLLEETEWPLICAWLVKKGYQAT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glucagon (GCG, Glucagon, Glicentin, Glicentin-related polypeptide, Oxyntomodulin, Glucagon-like peptide 1, Incretin hormone, Glucagon-like peptide 1 (7-37), Glucagon-like peptide 1 (7-36), Glucagon-like peptide 2) (FITC) discontinued
030996-FITC 200 µL

Glucagon (GCG, Glucagon, Glicentin, Glicentin-related polypeptide, Oxyntomodulin, Glucagon-like peptide 1, Incretin hormone, Glucagon-like peptide 1 (7-37), Glucagon-like peptide 1 (7-36), Glucagon-like peptide 2) (FITC) discontinued

Sign In for Pricing
View Details
CFAP161 Antibody - C-terminal region : HRP (ARP53271_P050-HRP)
ARP53271_P050-HRP 100 µL

CFAP161 Antibody - C-terminal region : HRP (ARP53271_P050-HRP)

Sign In for Pricing
View Details
Anti-Manduca astacin Antibody, Carrier-free
DZ41008-carrier-free 200 µL/Vial

Anti-Manduca astacin Antibody, Carrier-free

Sign In for Pricing
View Details
CALCA Recombinant Protein
OPCD06031-10UG 10 µg

CALCA Recombinant Protein

Sign In for Pricing
View Details
ASCT1 (C-8) Alexa Fluor® 790
sc-393157 AF790 200 µg/mL

ASCT1 (C-8) Alexa Fluor® 790

Sign In for Pricing
View Details
Human SKP2 (S-phase kinase-associated protein 2) ELISA Kit
EH2524 96 Tests

Human SKP2 (S-phase kinase-associated protein 2) ELISA Kit

Sign In for Pricing
View Details