Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus A Outer capsid protein VP4 protein

This Virus A Outer capsid protein VP4 protein spans the amino acid sequence from region 247-479aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hemagglutinin

UniProt

P35746

Expression Region

247-479aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARPNEDIIISKASLWKEVQYNRDIVIRFVFANNIIKAGGLGYKWSEISYKANNYQYTYMRDGVEVVAHTTVSVNGVSVYNYNTGPLPTDFMIRNYDVLKESSFVYVDYWDDSQAFRNMVYVRSLNAELNQVRCEGGHYSFALPVGSWPVMQGGSVILTFDGVTLSTQFTDYVSLNSLRFRFRCAVSEPSFRVTGTRISNLYGLPAANPMGDQQYYEAAGRFSLILLVPSNDDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Interleukin 17B ELISA Kit
MBS084136 Inquire

Pigeon Interleukin 17B ELISA Kit

Sign In for Pricing
View Details
UDP-glucose pyrophosphorylase 2
339021 100 µL

UDP-glucose pyrophosphorylase 2

Sign In for Pricing
View Details
C9orf98 (AK8) Human shRNA Plasmid Kit (Locus ID 158067)
TL307623 1 Kit

C9orf98 (AK8) Human shRNA Plasmid Kit (Locus ID 158067)

Sign In for Pricing
View Details
Lentiviral human YWHAZ shRNA (UAS) - Lentiviral human YWHAZ shRNA (UAS, GFP) (100)
GTR15324120 1 Vial

Lentiviral human YWHAZ shRNA (UAS) - Lentiviral human YWHAZ shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant other LLO PEST free Protein, Untagged, E.coli-50ug
QP10774-50ug 50ug

Recombinant other LLO PEST free Protein, Untagged, E.coli-50ug

Sign In for Pricing
View Details
Lentiviral human RSRP1 sgRNA gene knockout kit - Lentiviral human RSRP1 sgRNA gene knockout kit (100)
GTR15386623 1 Vial

Lentiviral human RSRP1 sgRNA gene knockout kit - Lentiviral human RSRP1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details