What is the catalog number for Virus A Outer capsid protein VP4 protein?

The catalog number for Virus A Outer capsid protein VP4 protein is orb604671.

What sizes are available for Virus A Outer capsid protein VP4 protein?

Virus A Outer capsid protein VP4 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Virus A Outer capsid protein VP4 protein come in?

Virus A Outer capsid protein VP4 protein is available in 3 different pack sizes.

Is Virus A Outer capsid protein VP4 protein in stock?

Virus A Outer capsid protein VP4 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Virus A Outer capsid protein VP4 protein

This Virus A Outer capsid protein VP4 protein spans the amino acid sequence from region 247-479aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hemagglutinin

UniProt

P35746

Expression Region

247-479aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARPNEDIIISKASLWKEVQYNRDIVIRFVFANNIIKAGGLGYKWSEISYKANNYQYTYMRDGVEVVAHTTVSVNGVSVYNYNTGPLPTDFMIRNYDVLKESSFVYVDYWDDSQAFRNMVYVRSLNAELNQVRCEGGHYSFALPVGSWPVMQGGSVILTFDGVTLSTQFTDYVSLNSLRFRFRCAVSEPSFRVTGTRISNLYGLPAANPMGDQQYYEAAGRFSLILLVPSNDDY