Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Klra3 protein

This Mouse Klra3 protein spans the amino acid sequence from region 70-266aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

5E6 Lymphocyte antigen 49c Short name, Ly-49c Nk2.1 T-cell surface glycoprotein Ly-49C Ly-49c, Ly49C

UniProt

Q64329

Expression Region

70-266aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QYNQHKQEINETLNHHHNCSNMQRAFNLKEEMLTNKSIDCRPSNETLEYIKREQDRWDSKTKTVLDSSRDTGRGVKYWFCYSTKCYYFIMNKTTWSGCKANCQHYSVPILKIEDEDELKFLQRHVIPENYWIGLSYDKKKKEWAWIDNGPSKLDMKIRKMNFKSRGCVFLSKARIEDIDCNIPYYCICGKKLDKFPD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Octenylsuccinic anhydride
19830-100 100 g

Octenylsuccinic anhydride

Sign In for Pricing
View Details
ABHD14B (NM_032750) Human Over-expression Lysate
LS084836 100 µg

ABHD14B (NM_032750) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human XRCC5
MBS7614638-01 0.05 mg

Recombinant Human XRCC5

Sign In for Pricing
View Details
Recombinant Human XRCC5
MBS7614638-02 0.2 mg

Recombinant Human XRCC5

Sign In for Pricing
View Details
Recombinant Human XRCC5
MBS7614638-03 1 mg

Recombinant Human XRCC5

Sign In for Pricing
View Details
Recombinant Human XRCC5
MBS7614638-04 5x 1 mg

Recombinant Human XRCC5

Sign In for Pricing
View Details