Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus A Outer capsid protein VP4 protein

This Virus A Outer capsid protein VP4 protein spans the amino acid sequence from region 248-480aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hemagglutinin

UniProt

P17465

Expression Region

248-480aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rotavirus A (strain RVA/Cow/United States/NCDV-Lincoln/1969/G6P6[1]) (RV-A) (Rotavirus A (strain Nebraska calf diarrhea virus) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQPNQDIVVSKTSLWKEMQYNRDIVIRFKFANSIIKSGGLGYKWSEVSFKPANYQYTYTRDGEEVTAHTTCSVNGINDFNYNGGSLPTDFVISKYEVIKENSFVYIDYWDDSQAFRNMVNVRSLAADLNSVMCTGGDYSFALPVGNYPVMTGGAVSLHSAGVTLSTQFTDFVSLNSLRFRFRLSVEEPPFSILRTRVSGLYGLPAARPNNSQEYYEIAGRFSLISLVPSNDDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTP1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-2735R-BF680 100 µL

GSTP1 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
ATP6V1E1 (V-type Proton ATPase Subunit E 1, V-ATPase Subunit E 1, V-ATPase 31kD Subunit, p31, Vacuolar Proton Pump Subunit E 1, ATP6E, ATP6E2) (MaxLight 750)
MBS6370791-01 0.1 mL

ATP6V1E1 (V-type Proton ATPase Subunit E 1, V-ATPase Subunit E 1, V-ATPase 31kD Subunit, p31, Vacuolar Proton Pump Subunit E 1, ATP6E, ATP6E2) (MaxLight 750)

Sign In for Pricing
View Details
ATP6V1E1 (V-type Proton ATPase Subunit E 1, V-ATPase Subunit E 1, V-ATPase 31kD Subunit, p31, Vacuolar Proton Pump Subunit E 1, ATP6E, ATP6E2) (MaxLight 750)
MBS6370791-02 5x 0.1 mL

ATP6V1E1 (V-type Proton ATPase Subunit E 1, V-ATPase Subunit E 1, V-ATPase 31kD Subunit, p31, Vacuolar Proton Pump Subunit E 1, ATP6E, ATP6E2) (MaxLight 750)

Sign In for Pricing
View Details
ISO20560PM-220X125-GEMENGD GAS Pipe Markers for Gases
316817 1 Pack (1 Marker (s) x 1 Card)

ISO20560PM-220X125-GEMENGD GAS Pipe Markers for Gases

Sign In for Pricing
View Details
IL17A, ID (IL17A, CTLA8, IL17, Interleukin-17A, Cytotoxic T-lymphocyte-associated antigen 8) (MaxLight 750)
MBS6309924-01 0.1 mL

IL17A, ID (IL17A, CTLA8, IL17, Interleukin-17A, Cytotoxic T-lymphocyte-associated antigen 8) (MaxLight 750)

Sign In for Pricing
View Details
IL17A, ID (IL17A, CTLA8, IL17, Interleukin-17A, Cytotoxic T-lymphocyte-associated antigen 8) (MaxLight 750)
MBS6309924-02 5x 0.1 mL

IL17A, ID (IL17A, CTLA8, IL17, Interleukin-17A, Cytotoxic T-lymphocyte-associated antigen 8) (MaxLight 750)

Sign In for Pricing
View Details