Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus A Outer capsid protein VP4 protein

This Virus A Outer capsid protein VP4 protein spans the amino acid sequence from region 248-480aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hemagglutinin

UniProt

P17465

Expression Region

248-480aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rotavirus A (strain RVA/Cow/United States/NCDV-Lincoln/1969/G6P6[1]) (RV-A) (Rotavirus A (strain Nebraska calf diarrhea virus) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQPNQDIVVSKTSLWKEMQYNRDIVIRFKFANSIIKSGGLGYKWSEVSFKPANYQYTYTRDGEEVTAHTTCSVNGINDFNYNGGSLPTDFVISKYEVIKENSFVYIDYWDDSQAFRNMVNVRSLAADLNSVMCTGGDYSFALPVGNYPVMTGGAVSLHSAGVTLSTQFTDFVSLNSLRFRFRLSVEEPPFSILRTRVSGLYGLPAARPNNSQEYYEIAGRFSLISLVPSNDDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PRPF18 sgRNA gene knockout kit - Lentiviral human PRPF18 sgRNA gene knockout kit (25)
GTR15391641 1 Vial

Lentiviral human PRPF18 sgRNA gene knockout kit - Lentiviral human PRPF18 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Il28b siRNA Oligos set (Mouse)
24875174 3x 5 nmol

Il28b siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
MRFAP1L1 Rabbit Polyclonal Antibody (BF555)
orb2486707 100 µL

MRFAP1L1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
FKBPL discontinued
505751-01 50 µL

FKBPL discontinued

Sign In for Pricing
View Details
FKBPL discontinued
505751-02 100 µL

FKBPL discontinued

Sign In for Pricing
View Details
E/IMO307-PP-PHOLUMB-150x150/1-B Marine & IMO Signs (No Adhesive)
195304 1 Pack (1 Panel (s) x 1 Pack)

E/IMO307-PP-PHOLUMB-150x150/1-B Marine & IMO Signs (No Adhesive)

Sign In for Pricing
View Details