Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine RETN protein

This Bovine RETN protein spans the amino acid sequence from region 19-109aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RSTN

UniProt

Q762I5

Expression Region

19-109aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cldn22 3'UTR Luciferase Stable Cell Line
TU202423 1.0 mL

Cldn22 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Tapbp (NM_009318) Mouse Tagged Lenti ORF Clone
MR207425L4 10 µg

Tapbp (NM_009318) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
1700007K09Rik shRNA Plasmid (m)
sc-108289-SH 20 µg

1700007K09Rik shRNA Plasmid (m)

Sign In for Pricing
View Details
H2AFZ, 1-128aa Human, His tag, E.coli
E53A02388 50 µg

H2AFZ, 1-128aa Human, His tag, E.coli

Sign In for Pricing
View Details
Magic™ Membrane Protein Human TAS2R16 (Taste 2 receptor member 16) Expressed in vitro E.coli expression system, Full Length
MPX2915K Each

Magic™ Membrane Protein Human TAS2R16 (Taste 2 receptor member 16) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Cytomegalovirus gB Antibody (Late cytoplasmic antigen) (FITC)
GWB-1A7D4F 0.1 mg

Cytomegalovirus gB Antibody (Late cytoplasmic antigen) (FITC)

Sign In for Pricing
View Details