Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine RETN protein

This Bovine RETN protein spans the amino acid sequence from region 19-109aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RSTN

UniProt

Q762I5

Expression Region

19-109aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human EZH2 sgRNA gene knockout kit - Lentiviral human EZH2 sgRNA gene knockout kit (100)
GTR15397072 1 Vial

Lentiviral human EZH2 sgRNA gene knockout kit - Lentiviral human EZH2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Influenza A virus PB2 protein Antibody
OAGA07178-100UL 100 µL

Influenza A virus PB2 protein Antibody

Sign In for Pricing
View Details
9 (R) -HODE
sc-205192 25 µg

9 (R) -HODE

Sign In for Pricing
View Details
Human PRELP (Proline Arginine Rich End Leucine Rich Repeat Protein) ELISA Kit
ELK3512-01 48 Tests

Human PRELP (Proline Arginine Rich End Leucine Rich Repeat Protein) ELISA Kit

Sign In for Pricing
View Details
Human PRELP (Proline Arginine Rich End Leucine Rich Repeat Protein) ELISA Kit
ELK3512-02 96 Tests

Human PRELP (Proline Arginine Rich End Leucine Rich Repeat Protein) ELISA Kit

Sign In for Pricing
View Details
Human PRELP (Proline Arginine Rich End Leucine Rich Repeat Protein) ELISA Kit
ELK3512-03 5x 96 Tests

Human PRELP (Proline Arginine Rich End Leucine Rich Repeat Protein) ELISA Kit

Sign In for Pricing
View Details