Human ATP5D protein
This Human ATP5D protein spans the amino acid sequence from region 23-168aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
F-ATPase delta subunit
UniProt
P30049
Expression Region
23-168aa
Tag
C-terminal 6xHis-Myc-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681282-500 1x 500 µL
ETS1 / (Marker of Tumor Metastasis) (ETS1/1282), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402117-100 1x 100 µL
ARF1 (Golgi Apparatus Marker) (ARF1/2117), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472554-100 1x 100 µL
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2554), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
F50597-0.08ML 0.08 mL
Epidermal growth factor receptor Antibody (EGFR)
Sign In for Pricing
View Details ![AF/LE Purified Anti-Mouse H-2 Antibody[M1/42]](https://cdn.genprice.uk/products/763/68dd14c4061270361e7d73c5/imageurl/e-ab-f12160.webp)
E-AB-F12160-01 100 µg
AF/LE Purified Anti-Mouse H-2 Antibody[M1/42]
Sign In for Pricing
View Details