Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP5D protein

This Human ATP5D protein spans the amino acid sequence from region 23-168aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

F-ATPase delta subunit

UniProt

P30049

Expression Region

23-168aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAELVGTADEATRAEIQIRIEANEALVKALE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPXM2 Antibody
8C14967-AAT 50 µg

CPXM2 Antibody

Sign In for Pricing
View Details
Human C3orf32 (SSUH2) activation kit by CRISPRa
GA109532 1 Kit

Human C3orf32 (SSUH2) activation kit by CRISPRa

Sign In for Pricing
View Details
Human RBM25 activation kit by CRISPRa
GA111796 1 Kit

Human RBM25 activation kit by CRISPRa

Sign In for Pricing
View Details
CO2 Incubator Air Jacketed BCAJ-8401
BCAJ-8401 1 Unit

CO2 Incubator Air Jacketed BCAJ-8401

Sign In for Pricing
View Details
Human Inversin (INVS) activation kit by CRISPRa
GA109026 1 Kit

Human Inversin (INVS) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant ECPAS Antibody
RN-13291-01 50 μL

Recombinant ECPAS Antibody

Sign In for Pricing
View Details