Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zebrafish vwc2l protein

This Zebrafish vwc2l protein spans the amino acid sequence from region 22-223aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vwc2l, si, ch211-207d8.1, von Willebrand factor C domain-containing protein 2-like

UniProt

B0UZC8

Expression Region

22-223aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASVGPEDYPAADEAERTANNDIIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYRGKTYKILEEFKPSPCEWCRCEPNNEVHCVVADCAVPECVNPVYEPEQCCPICKNGPNCFAGTTIIPAGIEVKVDDCTICRCHSGDWWKPAQCLRRECLNGQATS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2afz (H2az1) (NM_016750) Mouse Tagged Lenti ORF Clone
MR200694L4 10 µg

H2afz (H2az1) (NM_016750) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cys-CD36 (139-155) trifluoroacetate salt
FC108831-01 1000 µg

Cys-CD36 (139-155) trifluoroacetate salt

Sign In for Pricing
View Details
Cys-CD36 (139-155) trifluoroacetate salt
FC108831-02 2000 µg

Cys-CD36 (139-155) trifluoroacetate salt

Sign In for Pricing
View Details
Cys-CD36 (139-155) trifluoroacetate salt
FC108831-03 5000 μg

Cys-CD36 (139-155) trifluoroacetate salt

Sign In for Pricing
View Details
Cys-CD36 (139-155) trifluoroacetate salt
FC108831-04 10000 μg

Cys-CD36 (139-155) trifluoroacetate salt

Sign In for Pricing
View Details
SERPINB3 Monoclonal Antibody, HRP Conjugated
bsm-43190M-HRP 100 µL

SERPINB3 Monoclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details