Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zebrafish vwc2l protein

This Zebrafish vwc2l protein spans the amino acid sequence from region 22-223aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Vwc2l, si, ch211-207d8.1, von Willebrand factor C domain-containing protein 2-like

UniProt

B0UZC8

Expression Region

22-223aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASVGPEDYPAADEAERTANNDIIFDDYRGKGCVDDSGFVYKLGERFFPGHSNCPCVCTEDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYRGKTYKILEEFKPSPCEWCRCEPNNEVHCVVADCAVPECVNPVYEPEQCCPICKNGPNCFAGTTIIPAGIEVKVDDCTICRCHSGDWWKPAQCLRRECLNGQATS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTH2R Antibody
E94058 100 µg

PTH2R Antibody

Sign In for Pricing
View Details
Ahr (NM_013149) Rat Untagged Clone
RN202243 10 µg

Ahr (NM_013149) Rat Untagged Clone

Sign In for Pricing
View Details
Bovine Tissue Inhibitors Of Metalloproteinase 4 (TIMP4) ELISA Kit
RD-TIMP4-b-96Tests 96 Tests

Bovine Tissue Inhibitors Of Metalloproteinase 4 (TIMP4) ELISA Kit

Sign In for Pricing
View Details
Vwce 3'UTR Luciferase Stable Cell Line
TU122176 1.0 mL

Vwce 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-SLC5A11 Antibody Picoband® Fluoro550 Conjugated
A10043-2-Fluoro550 100 µg/Vial

Anti-SLC5A11 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Nfe2 (NM_001302341) Mouse Tagged ORF Clone
MR229554 10 µg

Nfe2 (NM_001302341) Mouse Tagged ORF Clone

Sign In for Pricing
View Details