Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ecel1 protein

This Mouse Ecel1 protein spans the amino acid sequence from region 1-61aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Damage-induced neuronal endopeptidase Xce protein Dine, Xce

UniProt

Q9JMI0

Expression Region

1-61aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor Necrosis Factor Receptor 1, Soluble, Recombinant, Human (sTNFR1)
T9162-50-01 5 µg

Tumor Necrosis Factor Receptor 1, Soluble, Recombinant, Human (sTNFR1)

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor 1, Soluble, Recombinant, Human (sTNFR1)
T9162-50-02 20 µg

Tumor Necrosis Factor Receptor 1, Soluble, Recombinant, Human (sTNFR1)

Sign In for Pricing
View Details
ZNF348/Kaiso Rabbit Polyclonal Antibody (BF350)
orb2491725 100 µL

ZNF348/Kaiso Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Lentiviral human UBE3C sgRNA gene knockout kit - Lentiviral human UBE3C sgRNA gene knockout kit (plasmid)
GTR15399062 1 Vial

Lentiviral human UBE3C sgRNA gene knockout kit - Lentiviral human UBE3C sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Adrenodoxin Recombinant Rabbit mAb, APC-Cy7 conjugated
orb3164508 100 µL

Adrenodoxin Recombinant Rabbit mAb, APC-Cy7 conjugated

Sign In for Pricing
View Details
RPL18 Antibody
orb683862 100 µL

RPL18 Antibody

Sign In for Pricing
View Details