Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ecel1 protein

This Mouse Ecel1 protein spans the amino acid sequence from region 1-61aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Damage-induced neuronal endopeptidase Xce protein Dine, Xce

UniProt

Q9JMI0

Expression Region

1-61aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donkey Anti-Rabbit IgG H&L, BF405 conjugated
orb1817040-01 100 µL

Donkey Anti-Rabbit IgG H&L, BF405 conjugated

Sign In for Pricing
View Details
Donkey Anti-Rabbit IgG H&L, BF405 conjugated
orb1817040-02 1 mL

Donkey Anti-Rabbit IgG H&L, BF405 conjugated

Sign In for Pricing
View Details
CHIKV p130/Structural polyprotein Recombinant Antibody (DC1.9)
AMRe60074-01 50 µL

CHIKV p130/Structural polyprotein Recombinant Antibody (DC1.9)

Sign In for Pricing
View Details
CHIKV p130/Structural polyprotein Recombinant Antibody (DC1.9)
AMRe60074-02 100 µL

CHIKV p130/Structural polyprotein Recombinant Antibody (DC1.9)

Sign In for Pricing
View Details
DTX3 Rabbit pAb, AE conjugated
orb2864303 100 µL

DTX3 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Anti-Purple sea urchin FoxL2 Antibody, PE Conjugate
DZ41451-PE 200 µL/Vial

Anti-Purple sea urchin FoxL2 Antibody, PE Conjugate

Sign In for Pricing
View Details