Human Orexin Receptor protein
This Human Orexin Receptor protein spans the amino acid sequence from region 1-46aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Hypocretin receptor type 1
UniProt
O43613
Expression Region
1-46aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
10.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ALIX Recombinant Rabbit Monoclonal Antibody [JM85-31]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80ed0/imageurl/et1705-74.webp)
ET1705-74 100 µL
ALIX Recombinant Rabbit Monoclonal Antibody [JM85-31]
Sign In for Pricing
View Details 
HA750664 100 µL
Pancreatic Polypeptide Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
E-EL-H5314-01 24 Tests
Human pMAPT /pTAU (phosphorylated microtubule-associated protein tau) ELISA Kit
Sign In for Pricing
View Details E-EL-H5314-02 48 Tests
Human pMAPT /pTAU (phosphorylated microtubule-associated protein tau) ELISA Kit
Sign In for Pricing
View Details E-EL-H5314-03 96 Tests
Human pMAPT /pTAU (phosphorylated microtubule-associated protein tau) ELISA Kit
Sign In for Pricing
View Details ![CD45 / LCA Rat Monoclonal Antibody [Clone ID: IBL-5/25]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fd1b5/imageurl/am31886pu-n.webp)
AM31886PU-N 250 µg
CD45 / LCA Rat Monoclonal Antibody [Clone ID: IBL-5/25]
Sign In for Pricing
View Details