What is the catalog number for Bacteria fim3 protein?

The catalog number for Bacteria fim3 protein is orb605425.

What sizes are available for Bacteria fim3 protein?

Bacteria fim3 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bacteria fim3 protein come in?

Bacteria fim3 protein is available in 3 different pack sizes.

Is Bacteria fim3 protein in stock?

Bacteria fim3 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bacteria fim3 protein

This Bacteria fim3 protein spans the amino acid sequence from region 26-204aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fim3, BP1568, Serotype 3 fimbrial subunit

UniProt

P17835

Expression Region

26-204aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP