Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KIR2DS3 protein

This Human KIR2DS3 protein spans the amino acid sequence from region 22-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC class I NK cell receptor Natural killer-associated transcript 7 NKAT7

UniProt

Q14952

Expression Region

22-245aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr117 shRNA (m) Lentiviral Particles
sc-150337-V 200 µL

Olfr117 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
PACRG (GLUP, Parkin Coregulated Gene Protein, Molecular Chaperone/Chaperonin-binding Protein, PARK2 Coregulated Gene Protein, FLJ32724, HAK005771, PARK2CRG, RP3-495O10.2) (AP) discontinued
130812-AP 100 µL

PACRG (GLUP, Parkin Coregulated Gene Protein, Molecular Chaperone/Chaperonin-binding Protein, PARK2 Coregulated Gene Protein, FLJ32724, HAK005771, PARK2CRG, RP3-495O10.2) (AP) discontinued

Sign In for Pricing
View Details
UBIAD1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV697019 1.0 µg DNA

UBIAD1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Rat SLC5A7 siRNA
abx934090-01 15 nmol

Rat SLC5A7 siRNA

Sign In for Pricing
View Details
Rat SLC5A7 siRNA
abx934090-02 30 nmol

Rat SLC5A7 siRNA

Sign In for Pricing
View Details
Recombinant Escherichia coli Undecaprenyl-diphosphatase (uppP)
orb2907578-01 20 µg

Recombinant Escherichia coli Undecaprenyl-diphosphatase (uppP)

Sign In for Pricing
View Details