Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Xenopus wnt8 protein

This Xenopus wnt8 protein spans the amino acid sequence from region 23-358aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Wnt8, Protein Wnt-8, XWnt-8

UniProt

P28026

Expression Region

23-358aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Xenopus laevis (African clawed frog)

Field of Research

Developmental Biology, Epigenetics, Neuroscience, Signaling Pathways, Wnt

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AWSVNNFLMTGPKAYLTYSASVAVGAQNGIEECKYQFAWERWNCPESTLQLATHNGLRSATRETSFVHAISSAGVMYTLTRNCSMGDFDNCGCDDSRNGRIGGRGWVWGGCSDNAEFGERISKLFVDGLETGQDARALMNLHNNEAGRLAVKETMKRTCKCHGISGSCSIQTCWLQLAEFRDIGNHLKIKHDQALKLEMDKRKMRSGNSADNRGAIADAFSSVAGSELIFLEDSPDYCLKNISLGLQGTEGRECLQSGKNLSQWERRSCKRLCTDCGLRVEEKKTEIISSCNCKFHWCCTVKCEQCKQVVIKHFCARRERDSNMLNTKRKNRGHRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ADAM22 Antibody
RN-14443-01 50 μL

Recombinant ADAM22 Antibody

Sign In for Pricing
View Details
Recombinant ADAM22 Antibody
RN-14443-02 100 µL

Recombinant ADAM22 Antibody

Sign In for Pricing
View Details
Recombinant ADAM22 Antibody
RN-14443-03 1 mL

Recombinant ADAM22 Antibody

Sign In for Pricing
View Details
Tmprss12 Mouse Gene Knockout Kit (CRISPR)
KN517937 1 Kit

Tmprss12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PIK3R5 antibody
FNab06416 100 µg

PIK3R5 antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Cartilage: tibia, proximal
CS713555 5x 5 µm

Tissue FFPE Sections, Cartilage: tibia, proximal

Sign In for Pricing
View Details