Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate SNCG protein

This Primate SNCG protein spans the amino acid sequence from region 1-127aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SNCG, QflA-20719, Gamma-synuclein

UniProt

Q2PFW6

Expression Region

1-127aa

Tag

Tag-Free

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chicken Insulin-Like Growth factor 1 (IGF1)
AP2C499-01 1 mg

Recombinant Chicken Insulin-Like Growth factor 1 (IGF1)

Sign In for Pricing
View Details
Recombinant Chicken Insulin-Like Growth factor 1 (IGF1)
AP2C499-02 100 µg

Recombinant Chicken Insulin-Like Growth factor 1 (IGF1)

Sign In for Pricing
View Details
Recombinant Chicken Insulin-Like Growth factor 1 (IGF1)
AP2C499-03 20 µg

Recombinant Chicken Insulin-Like Growth factor 1 (IGF1)

Sign In for Pricing
View Details
Lentiviral mouse Wrap73 shRNA (UAS) - Lentiviral mouse Wrap73 shRNA (UAS, iRFP) (25)
GTR15190334 1 Vial

Lentiviral mouse Wrap73 shRNA (UAS) - Lentiviral mouse Wrap73 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
TUBG2 Rabbit Polyclonal Antibody
orb514552 100 µg

TUBG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POU3F3 Antibody (Center)
MBS9213745-01 0.08 mL

POU3F3 Antibody (Center)

Sign In for Pricing
View Details