Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Primate SNCG protein

This Primate SNCG protein spans the amino acid sequence from region 1-127aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SNCG, QflA-20719, Gamma-synuclein

UniProt

Q2PFW6

Expression Region

1-127aa

Tag

Tag-Free

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAKTVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL7 rabbit polyclonal antibody, Aff - Purified
PP1029P1 50 µg

IL7 rabbit polyclonal antibody, Aff - Purified

Sign In for Pricing
View Details
WISP3 sgRNA CRISPR Lentivector (Human) (Target 1)
K2640802 1.0 µg DNA

WISP3 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Spermatogenesis-associated protein 9 (SPATA9) Bovine ELISA Kit
H2728 96 Tests

Spermatogenesis-associated protein 9 (SPATA9) Bovine ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal LRRC8B Antibody [Alexa Fluor 488]
NBP2-99221AF488 0.1 mL

Rabbit Polyclonal LRRC8B Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
GNAS Rabbit Polyclonal Antibody (BF488)
orb2425901 100 µL

GNAS Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
PWP1 Rabbit Polyclonal Antibody
TA366034 100 µL

PWP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details