Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus YNK1 protein

This Virus YNK1 protein spans the amino acid sequence from region 1-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NDK1, YNK

UniProt

P36010

Expression Region

1-153aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rabbit Alpha-1D adrenergic receptor (ADRA1D)
orb2903681-01 20 µg

Recombinant Rabbit Alpha-1D adrenergic receptor (ADRA1D)

Sign In for Pricing
View Details
Recombinant Rabbit Alpha-1D adrenergic receptor (ADRA1D)
orb2903681-02 100 µg

Recombinant Rabbit Alpha-1D adrenergic receptor (ADRA1D)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)
MBS2148757-01 0.1 mL

PE-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)
MBS2148757-02 0.2 mL

PE-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)
MBS2148757-03 0.5 mL

PE-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)
MBS2148757-04 1 mL

PE-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)

Sign In for Pricing
View Details