Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A14 protein

This Human S100A14 protein spans the amino acid sequence from region 1-104aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S100 calcium-binding protein A14 Short name, S114 S100A15

UniProt

Q9HCY8

Expression Region

1-104aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSF4 (Heat Shock Transcription Factor 4, CTM) (MaxLight 550)
MBS6217412-01 0.1 mL

HSF4 (Heat Shock Transcription Factor 4, CTM) (MaxLight 550)

Sign In for Pricing
View Details
HSF4 (Heat Shock Transcription Factor 4, CTM) (MaxLight 550)
MBS6217412-02 5x 0.1 mL

HSF4 (Heat Shock Transcription Factor 4, CTM) (MaxLight 550)

Sign In for Pricing
View Details
UBE2E1 Human Over-expression Lysate
orb1375094 20 µg

UBE2E1 Human Over-expression Lysate

Sign In for Pricing
View Details
A1BG (alpha-1-B Glycoprotein, A1B, ABG, DKFZp686F0970, GAB, HYST2477) (MaxLight 650)
MBS6226378-01 0.1 mL

A1BG (alpha-1-B Glycoprotein, A1B, ABG, DKFZp686F0970, GAB, HYST2477) (MaxLight 650)

Sign In for Pricing
View Details
A1BG (alpha-1-B Glycoprotein, A1B, ABG, DKFZp686F0970, GAB, HYST2477) (MaxLight 650)
MBS6226378-02 5x 0.1 mL

A1BG (alpha-1-B Glycoprotein, A1B, ABG, DKFZp686F0970, GAB, HYST2477) (MaxLight 650)

Sign In for Pricing
View Details
Gm6890 3'UTR GFP Stable Cell Line
TU158497 1.0 mL

Gm6890 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details