Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S100A14 protein

This Human S100A14 protein spans the amino acid sequence from region 1-104aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S100 calcium-binding protein A14 Short name, S114 S100A15

UniProt

Q9HCY8

Expression Region

1-104aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDOC Blocking Peptide
MBS8229962-01 1 mg

ALDOC Blocking Peptide

Sign In for Pricing
View Details
ALDOC Blocking Peptide
MBS8229962-02 5 mg

ALDOC Blocking Peptide

Sign In for Pricing
View Details
ALDOC Blocking Peptide
MBS8229962-03 5x 5 mg

ALDOC Blocking Peptide

Sign In for Pricing
View Details
hsa-miR-3118 miRNA Mimic
MBS8298943-01 5 nmol

hsa-miR-3118 miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-3118 miRNA Mimic
MBS8298943-02 10 nmol

hsa-miR-3118 miRNA Mimic

Sign In for Pricing
View Details
hsa-miR-3118 miRNA Mimic
MBS8298943-03 5x 10 nmol

hsa-miR-3118 miRNA Mimic

Sign In for Pricing
View Details