Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NR4A2 protein

This Human NR4A2 protein spans the amino acid sequence from region 1-598aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immediate-early response protein NOT Orphan nuclear receptor NURR1 Transcriptionally-inducible nuclear receptor NOT, NURR1, TINUR

UniProt

P43354

Expression Region

1-598aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human INTERLEUKIN-32A
MBS226189-01 0.01 mg

Recombinant Human INTERLEUKIN-32A

Sign In for Pricing
View Details
Recombinant Human INTERLEUKIN-32A
MBS226189-02 5x 0.01 mg

Recombinant Human INTERLEUKIN-32A

Sign In for Pricing
View Details
6-Trifluoromethyl pyrimidin-4-ylamine
Fr213049-01 50 mg

6-Trifluoromethyl pyrimidin-4-ylamine

Sign In for Pricing
View Details
6-Trifluoromethyl pyrimidin-4-ylamine
Fr213049-02 200 mg

6-Trifluoromethyl pyrimidin-4-ylamine

Sign In for Pricing
View Details
8-Nitroguanine
112127 1.0mg

8-Nitroguanine

Sign In for Pricing
View Details
ROX tetrazine, 5-isomer, 25 mg
412E0 25 mg

ROX tetrazine, 5-isomer, 25 mg

Sign In for Pricing
View Details