Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NR4A2 protein

This Human NR4A2 protein spans the amino acid sequence from region 1-598aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immediate-early response protein NOT Orphan nuclear receptor NURR1 Transcriptionally-inducible nuclear receptor NOT, NURR1, TINUR

UniProt

P43354

Expression Region

1-598aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

68.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSRGSPSNEGLCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKSPQEPSPPSPPVSLISALVRAHVDSNPAMTSLDYSRFQANPDYQMSGDDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADLPKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFGEWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNKIVNCLKDHVTFNNGGLNRPNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPAIIDKLFLDTLPF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Skint5 (m) -PR
sc-151548-PR 10 µM - 20 µL

Skint5 (m) -PR

Sign In for Pricing
View Details
MYCN Antibody
27-482 100 µL

MYCN Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal eIF5A2 Antibody (002) [DyLight 650]
NBP2-90305C 0.1 mL

Rabbit Monoclonal eIF5A2 Antibody (002) [DyLight 650]

Sign In for Pricing
View Details
Rat Monoclonal Syndecan-1/CD138 Antibody (359103R) [Alexa Fluor 532]
FAB2780RX 0.1 mL

Rat Monoclonal Syndecan-1/CD138 Antibody (359103R) [Alexa Fluor 532]

Sign In for Pricing
View Details
BUD31 Recombinant Protein
32-3358-10 10 µg

BUD31 Recombinant Protein

Sign In for Pricing
View Details
ALLERGEN Food mix (cereals: f4-f6-f7-f8-f9)
51-40 1 Each

ALLERGEN Food mix (cereals: f4-f6-f7-f8-f9)

Sign In for Pricing
View Details