What is the catalog number for Mouse Asgr2 protein?

The catalog number for Mouse Asgr2 protein is orb603923.

What sizes are available for Mouse Asgr2 protein?

Mouse Asgr2 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Mouse Asgr2 protein come in?

Mouse Asgr2 protein is available in 3 different pack sizes.

Is Mouse Asgr2 protein in stock?

Mouse Asgr2 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Mouse Asgr2 protein

This Mouse Asgr2 protein spans the amino acid sequence from region 80-301aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hepatic lectin 2 Short name, HL-2 Short name, mHL-2 Asgr-2

UniProt

P24721

Expression Region

80-301aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH