Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Asgr2 protein

This Mouse Asgr2 protein spans the amino acid sequence from region 80-301aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hepatic lectin 2 Short name, HL-2 Short name, mHL-2 Asgr-2

UniProt

P24721

Expression Region

80-301aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 633 Anti-human CD56 Antibody *My31*
105620E1-AAT 500 Tests

IFluor® 633 Anti-human CD56 Antibody *My31*

Sign In for Pricing
View Details
Human IL18BP (Interleukin 18 Binding Protein) ELISA Kit
orb1784687-01 48 Tests

Human IL18BP (Interleukin 18 Binding Protein) ELISA Kit

Sign In for Pricing
View Details
Human IL18BP (Interleukin 18 Binding Protein) ELISA Kit
orb1784687-02 96 Tests

Human IL18BP (Interleukin 18 Binding Protein) ELISA Kit

Sign In for Pricing
View Details
Nup54 Lentiviral Activation Particles (m2)
sc-435315-LAC-2 200 µL

Nup54 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Ces2 (NM_001271303) Rat Untagged Clone
RN216916 10 µg

Ces2 (NM_001271303) Rat Untagged Clone

Sign In for Pricing
View Details
Pro-Gastrin Releasing Peptide (ProGRP) Human ELISA Kit
10367 96 Tests

Pro-Gastrin Releasing Peptide (ProGRP) Human ELISA Kit

Sign In for Pricing
View Details