Plant Phleum pratense Pollen allergen Phl p 5a protein
This Plant Phleum pratense Pollen allergen Phl p 5a protein spans the amino acid sequence from region 1-286aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Pollen allergen Phl p 5a, Allergen Phl p Va, allergen Phl p 5a, Fragment
UniProt
Q40962
Expression Region
1-286aa
Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Phleum pratense (Common timothy)
Field of Research
Neuroscience
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
48.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940050-100 1x 100 µL
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680806-100 1x 100 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400630-100 1x 100 µL
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471231-500 1x 500 µL
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682848-100 1x 100 µL
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details