Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fpr1 protein

This Mouse Fpr1 protein spans the amino acid sequence from region 1-35aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-formyl peptide receptor Short name, FPR N-formylpeptide chemoattractant receptor

UniProt

P33766

Expression Region

1-35aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chst5 3'UTR GFP Stable Cell Line
TU252344 1.0 mL

Chst5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Erlin1 (NM_145502) Mouse Tagged Lenti ORF Clone
MR217210L3 10 µg

Erlin1 (NM_145502) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MTX1 Recombinant Protein
OPCD00886-10UG 10 µg

MTX1 Recombinant Protein

Sign In for Pricing
View Details
S-100A10 CRISPR Activation Plasmid (m2)
sc-422778-ACT-2 20 µg

S-100A10 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
CRRSP38 Antibody
orb786456 2 mg

CRRSP38 Antibody

Sign In for Pricing
View Details
PD-1 Biosimilar Antibody
orb2669971-01 50 µg

PD-1 Biosimilar Antibody

Sign In for Pricing
View Details