Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fpr1 protein

This Mouse Fpr1 protein spans the amino acid sequence from region 1-35aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-formyl peptide receptor Short name, FPR N-formylpeptide chemoattractant receptor

UniProt

P33766

Expression Region

1-35aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Angiotensin II Receptor Type 2 (AGTR2) ELISA Kit
abx570191-01 96 Tests

Human Angiotensin II Receptor Type 2 (AGTR2) ELISA Kit

Sign In for Pricing
View Details
Human Angiotensin II Receptor Type 2 (AGTR2) ELISA Kit
abx570191-02 5x 96 Tests

Human Angiotensin II Receptor Type 2 (AGTR2) ELISA Kit

Sign In for Pricing
View Details
Human Angiotensin II Receptor Type 2 (AGTR2) ELISA Kit
abx570191-03 10x 96 Tests

Human Angiotensin II Receptor Type 2 (AGTR2) ELISA Kit

Sign In for Pricing
View Details
Human DnaJ homolog subfamily C member 8 (DNAJC8) ELISA Kit
abx510732 96 Tests

Human DnaJ homolog subfamily C member 8 (DNAJC8) ELISA Kit

Sign In for Pricing
View Details
C2cd4c (NM_001168624) Mouse Tagged ORF Clone Lentiviral Particle
MR206656L4V 200 µL

C2cd4c (NM_001168624) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
NMB Over-expression Lysate Product
GWB-688979 0.1 mg

NMB Over-expression Lysate Product

Sign In for Pricing
View Details