Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fpr1 protein

This Mouse Fpr1 protein spans the amino acid sequence from region 1-35aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-formyl peptide receptor Short name, FPR N-formylpeptide chemoattractant receptor

UniProt

P33766

Expression Region

1-35aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-124-3p Primers
MPH02103 150 µL / 10 µM

hsa-miR-124-3p Primers

Sign In for Pricing
View Details
MSH2 Mouse Monoclonal Antibody
orb1145866 100 µg

MSH2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ELISA Kit For U5 small nuclear ribonucleoprotein 200 kDa helicase
E3781m 96 Tests

ELISA Kit For U5 small nuclear ribonucleoprotein 200 kDa helicase

Sign In for Pricing
View Details
C5orf60 Polyclonal Antibody, Cy5 Conjugated
bs-15212R-Cy5 100 µL

C5orf60 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
AKR1D1 Protein Lysate (Mouse) with C-HA Tag
11701034 100 µg

AKR1D1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Recombinant Escherichia coli crcB Protein (aa 1-127) (strain K12)
VAng-Lsx02237-inquire Inquire

Recombinant Escherichia coli crcB Protein (aa 1-127) (strain K12)

Sign In for Pricing
View Details