Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fpr1 protein

This Mouse Fpr1 protein spans the amino acid sequence from region 1-35aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-formyl peptide receptor Short name, FPR N-formylpeptide chemoattractant receptor

UniProt

P33766

Expression Region

1-35aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trypsin-1 Double Nickase Plasmid (m)
sc-431096-NIC 20 µg

Trypsin-1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
SMCP Adenovirus (Mouse)
44436054 1.0 mL

SMCP Adenovirus (Mouse)

Sign In for Pricing
View Details
ROPN1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
40682154 3x 1.0 µg DNA

ROPN1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
CR1 Antibody
orb1410013-01 20 µg

CR1 Antibody

Sign In for Pricing
View Details
CR1 Antibody
orb1410013-02 100 µg

CR1 Antibody

Sign In for Pricing
View Details
CR1 Antibody
orb1410013-03 100 ug (without BSA and Azide)

CR1 Antibody

Sign In for Pricing
View Details