Virus A27L protein
This Virus A27L protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
A27L, A30L14 kDa fusion protein
UniProt
P33816
Expression Region
1-110aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Field of Research
Infectious Disease & Virology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
14.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![TRAF6 Recombinant Rabbit Monoclonal Antibody [JE01-42]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea81388/imageurl/ha722857.webp)
HA722857 100 µL
TRAF6 Recombinant Rabbit Monoclonal Antibody [JE01-42]
Sign In for Pricing
View Details 
LY401904 100 µg
FibuLin 5 (FBLN5) (NM_006329) Human Over-expression Lysate
Sign In for Pricing
View Details 
E-EL-M3113-01 24 Tests
Mouse ACE2 (Angiotensin I Converting Enzyme 2) ELISA Kit
Sign In for Pricing
View Details E-EL-M3113-02 48 Tests
Mouse ACE2 (Angiotensin I Converting Enzyme 2) ELISA Kit
Sign In for Pricing
View Details