Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human THPO protein

This Human THPO protein spans the amino acid sequence from region 22-195aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-mpl ligand Short name, ML Megakaryocyte colony-stimulating factor Megakaryocyte growth and development factor Short name, MGDF Myeloproliferative leukemia virus oncogene ligand

UniProt

P40225

Expression Region

22-195aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cidec ORF Vector (Rat) (pORF)
ORF065022 1.0 µg DNA

Cidec ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Olfr800 Lentiviral Activation Particles (m2)
sc-434678-LAC-2 200 µL

Olfr800 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Anti-STK32A antibody
PAab08331 100 µg

Anti-STK32A antibody

Sign In for Pricing
View Details
Hydroxy safflor yellow A
C13911-1mg 1 mg

Hydroxy safflor yellow A

Sign In for Pricing
View Details
GCP-2 rabbit pAb
ES20287-01 50 µL

GCP-2 rabbit pAb

Sign In for Pricing
View Details
GCP-2 rabbit pAb
ES20287-02 100 µL

GCP-2 rabbit pAb

Sign In for Pricing
View Details