Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Cap protein

This Virus Cap protein spans the amino acid sequence from region 1-233aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cap, ORF2Capsid protein

UniProt

O56129

Expression Region

1-233aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Porcine circovirus 2 (PCV2)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMYVQFREFNLKDPPLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC5 (A717) polyclonal antibody
orb642911-01 25 µL

XRCC5 (A717) polyclonal antibody

Sign In for Pricing
View Details
XRCC5 (A717) polyclonal antibody
orb642911-02 50 μL

XRCC5 (A717) polyclonal antibody

Sign In for Pricing
View Details
XRCC5 (A717) polyclonal antibody
orb642911-03 100 µL

XRCC5 (A717) polyclonal antibody

Sign In for Pricing
View Details
XRCC5 (A717) polyclonal antibody
orb642911-04 200 µL

XRCC5 (A717) polyclonal antibody

Sign In for Pricing
View Details
TPP-PEG-Mal (MW 1000)
orb3137889-01 50 mg

TPP-PEG-Mal (MW 1000)

Sign In for Pricing
View Details
TPP-PEG-Mal (MW 1000)
orb3137889-02 10 mg

TPP-PEG-Mal (MW 1000)

Sign In for Pricing
View Details