Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Cap protein

This Virus Cap protein spans the amino acid sequence from region 1-233aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cap, ORF2Capsid protein

UniProt

O56129

Expression Region

1-233aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Porcine circovirus 2 (PCV2)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTYPRRRYRRRRHRPRSHLGQILRRRPWLVHPRHRYRWRRKNGIFNTRLSRTFGYTVKATTVRTPSWAVDMMRFNIDDFVPPGGGTNKISIPFEYYRIRKVKVEFWPCSPITQGDRGVGSTAVILDDNFVTKATALTYDPYVNYSSRHTIPQPFSYHSRYFTPKPVLDSTIDYFQPNNKRTQLWLRLQTSRNVDHVGLGTAFENSIYDQDYNIRVTMYVQFREFNLKDPPLKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LN-229-EGFP Cell Line
RG-280 1x 10^6

LN-229-EGFP Cell Line

Sign In for Pricing
View Details
SPLA2-IIA Inhibitor
HY-P10053 1 Each

SPLA2-IIA Inhibitor

Sign In for Pricing
View Details
IL-12 p80, Recombinant, Human discontinued
143383-01 2 µg

IL-12 p80, Recombinant, Human discontinued

Sign In for Pricing
View Details
IL-12 p80, Recombinant, Human discontinued
143383-02 10 µg

IL-12 p80, Recombinant, Human discontinued

Sign In for Pricing
View Details
Porcine cecropins P1 (CP1) ELISA Kit
YP-W71972-01 48 Tests

Porcine cecropins P1 (CP1) ELISA Kit

Sign In for Pricing
View Details
Porcine cecropins P1 (CP1) ELISA Kit
YP-W71972-02 96 Tests

Porcine cecropins P1 (CP1) ELISA Kit

Sign In for Pricing
View Details