Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine CLCA1 protein

This Porcine CLCA1 protein spans the amino acid sequence from region 46-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calcium-activated chloride channel family member 1 pCLCA1 AECC

UniProt

Q9TUB5

Expression Region

46-199aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cand2 Mouse Gene Knockout Kit (CRISPR)
KN502496 1 Kit

Cand2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Vimentin (VIM) ELISA Kit
RD-VIM-Hu-01 96 Tests

Human Vimentin (VIM) ELISA Kit

Sign In for Pricing
View Details
Human Vimentin (VIM) ELISA Kit
RD-VIM-Hu-02 48 Tests

Human Vimentin (VIM) ELISA Kit

Sign In for Pricing
View Details
epsilon-Viniferin
TRC-E214470-5MG 5 mg

epsilon-Viniferin

Sign In for Pricing
View Details
POTEM Human Gene Knockout Kit (CRISPR)
KN427212 1 Kit

POTEM Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Amplite® Colorimetric Maleimide Quantitation Kit
5525-AAT 100 Tests

Amplite® Colorimetric Maleimide Quantitation Kit

Sign In for Pricing
View Details