Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Porcine CLCA1 protein

This Porcine CLCA1 protein spans the amino acid sequence from region 46-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Calcium-activated chloride channel family member 1 pCLCA1 AECC

UniProt

Q9TUB5

Expression Region

46-199aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Sus scrofa (Pig)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene crosslinked with divinylbenzene, brominated
TRC-B686955-10MG 10 mg

Polystyrene crosslinked with divinylbenzene, brominated

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2 + ICO-106), CF568 conjugate, 0.1mg/mL
BNC680735-500 1x 500 µL

Human Lambda Light Chain (LcN-2 + ICO-106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COX18 (NM_001297733) Human Tagged ORF Clone
RG236343 10 µg

COX18 (NM_001297733) Human Tagged ORF Clone

Sign In for Pricing
View Details
TEKT2 Mouse Monoclonal Antibody [Clone ID: OTI1E6]
CF809968 100 µg

TEKT2 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

Sign In for Pricing
View Details
PPAR delta (PPARD) Mouse Monoclonal Antibody [Clone ID: OTI2D2]
CF811236 100 µg

PPAR delta (PPARD) Mouse Monoclonal Antibody [Clone ID: OTI2D2]

Sign In for Pricing
View Details
NUP50 Recombinant Rabbit Monoclonal Antibody [JE63-92]
HA721026 100 µL

NUP50 Recombinant Rabbit Monoclonal Antibody [JE63-92]

Sign In for Pricing
View Details