Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ALPP protein

This Human ALPP protein spans the amino acid sequence from region 117-447aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alkaline phosphatase Regan isozyme Placental alkaline phosphatase 1 PLAP

UniProt

P05187

Expression Region

117-447aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TATAYLCGVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFRMGTPDPEYPDDYSQGGTRLDGKNLVQEWLAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf215 CRISPRa sgRNA lentivector (set of three targets)(Human)
53833121 3x 1.0µg DNA

C6orf215 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Tdpoz5 Recombinant Protein (Mouse)
RP178037 100 µg

Tdpoz5 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Anti Guinea Pig IgG Pab Rat
164184 1 mg

Anti Guinea Pig IgG Pab Rat

Sign In for Pricing
View Details
ABD-F, 100 mg
A016-12 100 mg

ABD-F, 100 mg

Sign In for Pricing
View Details
Recombinant Human Testis-expressed protein 13C (TX13C), partial
orb3009335-01 20 µg

Recombinant Human Testis-expressed protein 13C (TX13C), partial

Sign In for Pricing
View Details
Recombinant Human Testis-expressed protein 13C (TX13C), partial
orb3009335-02 100 µg

Recombinant Human Testis-expressed protein 13C (TX13C), partial

Sign In for Pricing
View Details