Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Try4 protein

This Rat Try4 protein spans the amino acid sequence from region 24-247aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pretrypsinogen IV Trypsin IV

UniProt

P12788

Expression Region

24-247aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGYTCPKHLVPYQVSLHDGISHQCGGSLISDQWVLSAAHCYKRKLQVRLGEHNIHVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFCLGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue cDNA, First Strand, Canine Adult Normal, Cecum, BioGenomicsTM
T5595-0012E2 40 Tests

Tissue cDNA, First Strand, Canine Adult Normal, Cecum, BioGenomicsTM

Sign In for Pricing
View Details
LRG1 (LRG, Leucine-rich alpha-2-glycoprotein, HMFT1766, FLJ45787) (Biotin)
129198-Biotin 100 µL

LRG1 (LRG, Leucine-rich alpha-2-glycoprotein, HMFT1766, FLJ45787) (Biotin)

Sign In for Pricing
View Details
Rat Anti-Human G-CSF-LE/AF
MBS670058-01 0.5 mg

Rat Anti-Human G-CSF-LE/AF

Sign In for Pricing
View Details
Rat Anti-Human G-CSF-LE/AF
MBS670058-02 5x 0.5 mg

Rat Anti-Human G-CSF-LE/AF

Sign In for Pricing
View Details
Mouse Interleukin 1β (IL-1β) ELISA Kit
orb2656021-01 24 Tests

Mouse Interleukin 1β (IL-1β) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 1β (IL-1β) ELISA Kit
orb2656021-02 48 Tests

Mouse Interleukin 1β (IL-1β) ELISA Kit

Sign In for Pricing
View Details