Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tlr7 protein

This Mouse Tlr7 protein spans the amino acid sequence from region 27-348aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tlr7, Toll-like receptor 7

UniProt

P58681

Expression Region

27-348aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FRWFPKTLPCEVKVNIPEAHVIVDCTDKHLTEIPEGIPTNTTNLTLTINHIPSISPDSFRRLNHLEEIDLRCNCVPVLLGSKANVCTKRLQIRPGSFSGLSDLKALYLDGNQLLEIPQDLPSSLHLLSLEANNIFSITKENLTELVNIETLYLGQNCYYRNPCNVSYSIEKDAFLVMRNLKVLSLKDNNVTAVPTTLPPNLLELYLYNNIIKKIQENDFNNLNELQVLDLSGNCPRCYNVPYPCTPCENNSPLQIHDNAFNSLTELKVLRLHSNSLQHVPPTWFKNMRNLQELDLSQNYLAREIEEAKFLHFLPNLVELDFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Serp1 shRNA (UAS) - Lentiviral mouse Serp1 shRNA (UAS, iRFP) (100)
GTR15284631 1 Vial

Lentiviral mouse Serp1 shRNA (UAS) - Lentiviral mouse Serp1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Nonivamide
AB2518 20 mg

Nonivamide

Sign In for Pricing
View Details
ZIC5 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb920296 100 µL

ZIC5 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
SYNJ2BP (NM_018373) Human Over-expression Lysate
LS055333 100 µg

SYNJ2BP (NM_018373) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Calprotectin (CALP) ELISA Kit
YP-W10597-01 48 Tests

Human Calprotectin (CALP) ELISA Kit

Sign In for Pricing
View Details
Human Calprotectin (CALP) ELISA Kit
YP-W10597-02 96 Tests

Human Calprotectin (CALP) ELISA Kit

Sign In for Pricing
View Details