Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria fim3 protein

This Bacteria fim3 protein spans the amino acid sequence from region 26-204aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fim3, BP1568, Serotype 3 fimbrial subunit

UniProt

P17835

Expression Region

26-204aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gliomedin (m) -PR
sc-62379-PR 10 µM - 20 µL

Gliomedin (m) -PR

Sign In for Pricing
View Details
REXO4 siRNA (m)
sc-152821 10 µM

REXO4 siRNA (m)

Sign In for Pricing
View Details
SAMD4A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2086808 1.0 µg DNA

SAMD4A sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Vav1 (NM_001163816) Mouse Untagged Clone
MC220694 10 µg

Vav1 (NM_001163816) Mouse Untagged Clone

Sign In for Pricing
View Details
B7-H6 Rabbit Polyclonal Antibody (AP)
orb921116 100 µL

B7-H6 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
pCMV-SPORT6-EIF2S3-b Plasmid
PVT20197 2 µg

pCMV-SPORT6-EIF2S3-b Plasmid

Sign In for Pricing
View Details