Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ompC protein

This E. coli ompC protein spans the amino acid sequence from region 22-367aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outer membrane protein 1B Porin OmpC meoA, par

UniProt

P06996

Expression Region

22-367aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Integrin alpha L/CD11a Antibody (MEM-25) [Alexa Fluor 647]
NB500-328AF647 0.1 mL

Mouse Monoclonal Integrin alpha L/CD11a Antibody (MEM-25) [Alexa Fluor 647]

Sign In for Pricing
View Details
GFP hsa-mir-320b-1 AAV miRNA Vector
Amh1045400 500 ng

GFP hsa-mir-320b-1 AAV miRNA Vector

Sign In for Pricing
View Details
D-Mannitol
71640365-5kg 5 Kg

D-Mannitol

Sign In for Pricing
View Details
o-Toluidine Chloride
TRC-T536215-25G 25 g

o-Toluidine Chloride

Sign In for Pricing
View Details
Klra5 Protein Vector (Mouse) (pPM-C-HA)
25864024 500 ng

Klra5 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Phospho-MARCKS (Ser167/170) Antibody [A4H10]
C19455-50uL 50 μL

Phospho-MARCKS (Ser167/170) Antibody [A4H10]

Sign In for Pricing
View Details