Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli ompC protein

This E. coli ompC protein spans the amino acid sequence from region 22-367aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Outer membrane protein 1B Porin OmpC meoA, par

UniProt

P06996

Expression Region

22-367aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC11 Polyclonal Antibody, RBITC Conjugated
bs-20001R-RBITC 100 µL

SIGLEC11 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
GSN, NT (GSN, Gelsolin, AGEL, Actin-depolymerizing factor, Brevin) (MaxLight 550) discontinued
031003-ML550 100 µL

GSN, NT (GSN, Gelsolin, AGEL, Actin-depolymerizing factor, Brevin) (MaxLight 550) discontinued

Sign In for Pricing
View Details
ERICH2 shRNA (m) Lentiviral Particles
sc-140273-V 200 µL

ERICH2 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
TMF1 Antibody, HRP conjugated
CSB-PA023904LB01HU-01 50 µg

TMF1 Antibody, HRP conjugated

Sign In for Pricing
View Details
TMF1 Antibody, HRP conjugated
CSB-PA023904LB01HU-02 100 µg

TMF1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Gm14151 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3318503 1.0 µg DNA

Gm14151 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details